PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G49010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 314aa    MW: 34471.7 Da    PI: 9.323
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G49010.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding231.9e-07754345
                     SS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwq 45
                      W+ eE++ + +a++++  +      +W++ +++++  + l+++k ++q
      AT1G49010.1  7 TWSREEEKAFENAIALHCVEeeitedQWNKMSSMVP-SKALEEVKKHYQ 54
                     5****************999****************.***********9 PP

2Myb_DNA-binding38.82.1e-12135179347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
      AT1G49010.1 135 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 179
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.975361IPR017884SANT domain
SMARTSM007170.0017459IPR001005SANT/Myb domain
CDDcd001674.13E-6757No hitNo description
SuperFamilySSF466892.07E-8864IPR009057Homeodomain-like
PROSITE profilePS5129416.873128184IPR017930Myb domain
SuperFamilySSF466897.59E-17130185IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-17132182IPR006447Myb domain, plants
SMARTSM007172.3E-10132182IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-11133178IPR009057Homeodomain-like
CDDcd001671.13E-9135180No hitNo description
PfamPF002497.9E-11135179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MESVVATWSR EEEKAFENAI ALHCVEEEIT EDQWNKMSSM VPSKALEEVK KHYQILLEDV  60
KAIENGQVPL PRYHHRKGLI VDEAAAAATS PANRDSHSSG SSEKKPNPGT SGISSSNGGR  120
SGGSRAEQER RKGIPWTEEE HRLFLLGLDK FGKGDWRSIS RNFVISRTPT QVASHAQKYF  180
IRLNSMNRDR RRSSIHDITT VNNQAPAVTG GGQQPQVVKH RPAQPQPQPQ PQPQQHHPPT  240
MAGLGMYGGA PVGQPIIAPP DHMGSAVGTP VMLPPPMGTH HHHHHHHLGV APYAVPAYPV  300
PPLPQQHPAP STMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-138781178RADIALIS
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306944670.0
Genevisible260769_at0.0
Expression AtlasAT1G49010-
AtGenExpressAT1G49010-
ATTED-IIAT1G49010-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00191DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G49010.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G49010
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0869060.0AY086906.1 Arabidopsis thaliana clone 29302 mRNA, complete sequence.
GenBankAY5195280.0AY519528.1 Arabidopsis thaliana MYB transcription factor (At1g49010) mRNA, complete cds.
GenBankBT0248620.0BT024862.1 Arabidopsis thaliana At1g49010 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_564537.10.0myb/SANT-like DNA-binding domain-containing protein
SwissprotQ8S9H72e-56DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLQ9M9A30.0Q9M9A3_ARATH; At1g49010
STRINGAT1G49010.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM103042535
Representative plantOGRP27517122
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  3. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]